top of page
Analysis of DNA damage recognition and repair factor (XPA) in Homo sapiens
Jeffrey Chimenti & Rory Vanderberg
Published: December 9, 2019
The Project
This website counts as the final project for the course, Cell and Molecular Biology, at Ramapo College of New Jersey. Our professor, Dr. Paramjeet S. Bagga, provided us with the following task:
​
You have purified a protein by a combination of Molecular Sieve
(Gel-Filtration), Ion-Exchange and Affinity chromatography from cultured
HeLa cells. You have been able to determine a partial amino acid sequence
of the purified protein. Your goal is to determine if the gene for the
purified protein has already been cloned, by identifying it in an
appropriate protein database and other molecular databases. If cloned, and
if known, you want to study the structure and function of the gene and the
protein.
Given below is the partial amino acid sequence of the protein that you
purified:
VRASIERKRQRALMLRQARLAARPYSATAAAATGGMANVKAAPKIID
TGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLIT
KTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQEN
REKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEENL
The Objectives
Using the partial amino acid structure:
-
Use bioinformatics software to identify the protein and its corresponding gene
-
Analyze the structure, function, and sub-cellular localization of the protein​
-
Identify components of the gene and genomic sequences
-
Map diagrams for two pre-mRNA isoforms
-
Identify mutations and diseases associated with the gene/protein
bottom of page